PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_27514_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family SBP
Protein Properties Length: 1008aa    MW: 112888 Da    PI: 7.2349
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_27514_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.56e-41148224177
                                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT------ CS
                                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerr 73 
                                           +Cqve+C adls+ak+yhrrhkvCe+hska+ +lv +++qrfCqqCsrfh+l+efDe+krsCrrrLa+hn+rr
  cra_locus_27514_iso_1_len_3786_ver_3 148 VCQVEDCGADLSKAKDYHRRHKVCEMHSKASRALVGNVMQRFCQQCSRFHALQEFDEGKRSCRRRLAGHNKRR 220
                                           6************************************************************************ PP

                                           -S-- CS
                                   SBP  74 rkkq 77 
                                           rk++
  cra_locus_27514_iso_1_len_3786_ver_3 221 RKTK 224
                                           **87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-33142210IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.265146223IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-37147224IPR004333Transcription factor, SBP-box
PfamPF031108.6E-30149222IPR004333Transcription factor, SBP-box
SuperFamilySSF484031.52E-8740889IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.206.2E-7779889IPR020683Ankyrin repeat-containing domain
CDDcd002049.99E-8780889No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1008 aa     Download sequence    Send to blast
METQFFYRGL ASGELSMAGK RSLEWDPNVW KWNGDLFRAT PINPNPLDSR SRQFFPLEAG  60
NSMAGASPNS SSTCSDELSI GVDQGKHKRE LDKKRRAVVT EDDNSEQEPA NLALKLGGRG  120
YNKKEVETFD RTAGKKTKVA GTNSNRAVCQ VEDCGADLSK AKDYHRRHKV CEMHSKASRA  180
LVGNVMQRFC QQCSRFHALQ EFDEGKRSCR RRLAGHNKRR RKTKAAPDTK SSSLNDNHAS  240
GYLLMSILKI LSTLHSSDPN HKDDPDLLSH LIRSLVTHNS LHGGKDISEF LQKPQNFLNN  300
DPELITSLVT NGSQGNPVSE QQNCTNPIAV MPQEVFHTKD SGVEYSQSVP SKEHGLIYTQ  360
SSPFAYVQSK GIPEGRSKLN NFDLNDVYVD SDDGIEDLER SPFPADLRTT NLEYPSWTQQ  420
DSHQSSPPQT SGNSDSASAQ SPSSSTGDAQ SRTDRIVFKL FGKEPSDFPF GIRGQILDWL  480
SHSPTDIESY IRPGCVILTI YLRMAESAWE ELCCNLRSRL SRLLNVYDDT SFWRTGWIYV  540
RVQNHIVFIS NGHIVVDTSL PLIISNKSMI LSVKPIAVPQ SERAQFTVKG FNLSKPSTRL  600
LCALEGNYLE LESNGLGEDT CKLKGHDQHH CLKISCSVPE LVGRGFIEIE DLGLSSSFFP  660
FIVAEKDVCS EIRTLESEIE LIEEDCFQGK NRIETRNLAL DFIHEMGWLL RRSQLRSRLE  720
YLDRDPFCVP FKRFKWLVQF SADHGWCAVV KKLLDFLLDG TIAAGEQPFL KSALFEMGLL  780
HRAVRKNSRP LVELLLRYTP QDVSEELSSQ CISLGADQSF LFRPDAAGPA GLTPLHIAAG  840
RDGSDDVLDA LTDDPGEVAI EAWKNTRDNT GFTPEDYARL RGHYSYIHLV QRKIQKKLAS  900
TGHVVVDVQS SFSSGSMKQK QDDVLITASF EIARSETGAS FKQQPCRVCN KKLASGRRNS  960
CLLYRPAMLS MMAIAAVCVC VALLFKSSPE VVYVCRPFRW EYLDYGSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-301482221084squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1218223RRRKTK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010652308.10.0PREDICTED: squamosa promoter-binding-like protein 1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLF6HZE30.0F6HZE3_VITVI; Putative uncharacterized protein
STRINGVIT_07s0005g02260.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466